PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Han001383
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
Family NAC
Protein Properties Length: 309aa    MW: 34982.3 Da    PI: 8.154
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-169a-Helianthus_annuus-29842PU_refplantGDBView CDS
gnl|UG|Han#S32081677PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.91.6e-52171421128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrF Ptdeel+v+yL++kv+g+++ l ++i +v++yk++Pw+Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk ++s +g++v
  Han001383  17 LPPGFRFYPTDEELMVRYLCPKVAGNDFAL-RIIGDVNLYKFDPWELPSKAMFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVIMS-EGRKV 114
                79*************************999.89***************8777899***************************************.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfy g+apkg+kt+W+mheyrl
  Han001383 115 GIKKALVFYVGKAPKGSKTNWIMHEYRL 142
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-6813166IPR003441NAC domain
PROSITE profilePS5100560.89917165IPR003441NAC domain
PfamPF023655.7E-2618142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MVLRTLPVTD PTTQLKLPPG FRFYPTDEEL MVRYLCPKVA GNDFALRIIG DVNLYKFDPW  60
ELPSKAMFGE KEWYFFSPRD RKYPNGSRPN RVAGSGYWKA TGTDKVIMSE GRKVGIKKAL  120
VFYVGKAPKG SKTNWIMHEY RLSETSRDNN SSRLDDWVLC RIYKKNSSAE KSISGGPSIE  180
QSQGSPTSSS AHFDGGLDSL PAIDDRFLNF NEEDQKVDIR KFDTGNFDWV SLGPFGLPDT  240
VNHPNPPNST SLDPALNMQM KFVKSPEDEV QNEIRSQRME NSGYLFTPDT TDPFAIRYPT  300
QPGSSGYRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-9991719171NAC domain-containing protein 19
4dul_A3e-9991719171NAC domain-containing protein 19
1ut7_B3e-9991719171NO APICAL MERISTEM PROTEIN
1ut7_A3e-9991719171NO APICAL MERISTEM PROTEIN
1ut4_B3e-9991719171NO APICAL MERISTEM PROTEIN
1ut4_A3e-9991719171NO APICAL MERISTEM PROTEIN
3swp_D4e-99917112174NAC domain-containing protein 19
3swp_C4e-99917112174NAC domain-containing protein 19
3swp_B4e-99917112174NAC domain-containing protein 19
3swp_A4e-99917112174NAC domain-containing protein 19
3swm_D4e-99917112174NAC domain-containing protein 19
3swm_C4e-99917112174NAC domain-containing protein 19
3swm_B4e-99917112174NAC domain-containing protein 19
3swm_A4e-99917112174NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284668.11e-126PREDICTED: NAC domain-containing protein 72
SwissprotQ93VY31e-105NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A103Y4591e-151A0A103Y459_CYNCS; No apical meristem (NAM) protein
STRINGVIT_19s0014g03290.t011e-125(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-106NAC family protein